PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S03620.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ZF-HD
Protein Properties Length: 257aa    MW: 29009.2 Da    PI: 8.8158
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S03620.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer95.83.4e-303590259
    ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                   ++++YkeC++NhAas+Ggha DGCgEfmp     ++  +l+CaACgCHRnFHRre+e 
  Jcr4S03620.30 35 TNYKYKECMRNHAASIGGHANDGCGEFMPR--GAADDGSLTCAACGCHRNFHRRETEG 90
                   5789*************************9..44689******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.9E-263788IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-263887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.1693987IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-144193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-29165233IPR009057Homeodomain-like
SuperFamilySSF466895.57E-19165233IPR009057Homeodomain-like
TIGRFAMsTIGR015657.9E-27173229IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDLSLVPFQQ HTTKSRETHN HDLTKNYNNN SNNKTNYKYK ECMRNHAASI GGHANDGCGE  60
FMPRGAADDG SLTCAACGCH RNFHRRETEG TQLHSHHYEH FFLSPPPPPV PQQILLYNAG  120
GGGSPSTVNK KHLASHHEFF DDEDDHDRRS QTPERGEVNV GGLGGRATAV RNKRFRTKFT  180
QEQKDRMLEF AEKIGWRINK QDDVALKQFC SEIGVKRNVL KVWMHNNKNA HRRTREEGPL  240
PSTADPPPTV PSQPVGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-261722301775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075796.10.0PREDICTED: zinc-finger homeodomain protein 2-like
TrEMBLA0A067KFE01e-162A0A067KFE0_JATCU; Uncharacterized protein
STRINGPOPTR_0013s11330.14e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF150921014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15210.13e-47homeobox protein 30